bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: GPRC5A

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
GPRC5A 0 -0.754 -0.830 0.790

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
GPRC5A Phosphorylation S301 -0.095 -1.449 _AYS(ph)QEEITQGFEETGDTLYAPYSTHFQLQNQPPQK_

Background Information for GPRC5A:


Pubmed-GPRC5A »
Uniprot-GPRC5A »
Biogrid-GPRC5A »
ProteomicsDB-GPRC5A »

Tumorportal-GPRC5A »
COSMIC-GPRC5A »
GenomeRNAi-GPRC5A »
Genecards-GPRC5A


Protein-protein Interactions for GPRC5A
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait ACTB Cat. description Hein, Mann, Cell 2015
Category members IP bait ACTR2 Cat. description Hein, Mann, Cell 2015
Category members IP bait ATP6AP2 Cat. description Hein, Mann, Cell 2015
Category members IP bait BMPR1A Cat. description Hein, Mann, Cell 2015
Category members IP bait CEP55 Cat. description Hein, Mann, Cell 2015
Category members IP bait CHMP4B Cat. description Hein, Mann, Cell 2015
Category members IP bait CORO1C Cat. description Hein, Mann, Cell 2015
Category members IP bait DBN1 Cat. description Hein, Mann, Cell 2015
Category members IP bait FAM82A2 Cat. description Hein, Mann, Cell 2015
Category members IP bait FAM83D Cat. description Hein, Mann, Cell 2015
Category members IP bait FLOT1 Cat. description Hein, Mann, Cell 2015
Category members IP bait FLOT2 Cat. description Hein, Mann, Cell 2015
Category members IP bait GOLT1B Cat. description Hein, Mann, Cell 2015
Category members IP bait LIMA1 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYH10 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYH9 Cat. description Hein, Mann, Cell 2015
Category members IP bait MYO19 Cat. description Hein, Mann, Cell 2015
Category members IP bait PTPN23 Cat. description Hein, Mann, Cell 2015
Category members IP bait RAB5C Cat. description Hein, Mann, Cell 2015
Category members IP bait RAB7A Cat. description Hein, Mann, Cell 2015
Category members IP bait SYNPO Cat. description Hein, Mann, Cell 2015
Category members IP bait TMED2 Cat. description Hein, Mann, Cell 2015
Category members IP bait TSG101 Cat. description Hein, Mann, Cell 2015
Category members IP bait VPS4B Cat. description Hein, Mann, Cell 2015


Protein Domains in GPRC5A
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members GPCR_3_C IPR017978 0


Protein complexes (CORUM database) featuring GPRC5A
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring GPRC5A
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0016021 integral to membrane Database 7.67
Category members GO Category GO:0004930 G-protein coupled receptor activity Database 2.1
Category members GO Category GO:0005887 integral to plasma membrane Database 1.69
Category members GO Category GO:0007186 G-protein coupled receptor signaling pathway Database 1.53
Category members GO Category GO:0005886 plasma membrane Database 1.21
Category members GO Category GO:0030659 cytoplasmic vesicle membrane Database 0.62
Category members GO Category GO:0043231 intracellular membrane-bounded organelle Database 0.43
Category members GO Category GO:0005794 Golgi apparatus Database 0.27
Category members GO Category GO:0007165 signal transduction Database 0


.

© Copyright Svejstrup Laboratory 2015