bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: EIF4ENIF1

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
EIF4ENIF1 1 2.436 1.420 -0.750

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
EIF4ENIF1 Phosphorylation S670 1.989 _VTKS(ph)PAPVHR_
EIF4ENIF1 Phosphorylation S77 0.447 0.730 _S(ph)SPVESLKK_
EIF4ENIF1 Phosphorylation S78 -0.054 0.612 _SS(ph)PVESLK_
EIF4ENIF1 Phosphorylation S374 0.336 _LAGLEQAILS(ph)PGQNSGNYFAPIPLEDHAENKVDILEMLQK_
EIF4ENIF1 Phosphorylation S951 0.234 0.320 _SSS(ph)PVGLAK_
EIF4ENIF1 Phosphorylation S213 0.152 _RNDS(ph)YTEEEPEWFSAGPTSQSETIELTGFDDK_
EIF4ENIF1 Phosphorylation S746 -0.360 0.139 _ASEENLLSSSSVPS(ph)ADRDSSPTTNSK_
EIF4ENIF1 Phosphorylation S564 -0.455 -0.232 _APS(ph)PPLSQVFQTR_
EIF4ENIF1 Phosphorylation S587 -0.896 -1.021 _IPS(ph)PIGFTPGPQQLLGDPFQGM(ox)R_

Background Information for EIF4ENIF1:


Pubmed-EIF4ENIF1 »
Uniprot-EIF4ENIF1 »
Biogrid-EIF4ENIF1 »
ProteomicsDB-EIF4ENIF1 »

Tumorportal-EIF4ENIF1 »
COSMIC-EIF4ENIF1 »
GenomeRNAi-EIF4ENIF1 »
Genecards-EIF4ENIF1


Protein-protein Interactions for EIF4ENIF1
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait CERK Cat. description Hein, Mann, Cell 2015
Category members IP bait GTF2B Cat. description Hein, Mann, Cell 2015
Category members IP bait PRKCI Cat. description Hein, Mann, Cell 2015
Category members IP bait SEC16A Cat. description Hein, Mann, Cell 2015
Category members IP bait SMAD3 Cat. description Hein, Mann, Cell 2015
Category members IP bait TSC1 Cat. description Hein, Mann, Cell 2015
Category members IP bait ASB3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CDC16 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait EIF4E Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait EIF4E2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait HIF1AN Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait KLHDC3 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in EIF4ENIF1
Domain name Domain Description TC-NER relevance -log10(p-value)


Protein complexes (CORUM database) featuring EIF4ENIF1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring EIF4ENIF1
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005829 cytosol Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0016607 nuclear speck Database 4.84
Category members GO Category GO:0016605 PML body Database 1.41
Category members GO Category GO:0003743 translation initiation factor activity Database 0.71
Category members GO Category GO:0043231 intracellular membrane-bounded organelle Database 0.43
Category members GO Category GO:0008565 protein transporter activity Database 0.26


.

© Copyright Svejstrup Laboratory 2015