bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Data

bioLOGIC Data


Exact search

Query: CLASRP

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
CLASRP 0 0.084 0.070 0.140 -0.175

PTM Sites:

Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
CLASRP Phosphorylation S285 0.137 -0.018 _KIS(ph)PPSYAR_
CLASRP Phosphorylation S294 -0.224 -0.038 _RDS(ph)PTYDPYKR_
CLASRP Phosphorylation S547 -0.625 -0.638 _LTRPAAS(ph)PAVGEK_
CLASRP Phosphorylation S101 -0.346 -0.974 _AHLDHIPDYTPPLLTTIS(ph)PEQESDER_
CLASRP Phosphorylation S335 -1.254 -1.457 _ITFITSFGGS(ph)DEEAAAAAAAAAASGVTTGKPPAPPQPGGPAPGR_
CLASRP Phosphorylation S331 -1.827 _ITFITS(ph)FGGSDEEAAAAAAAAAASGVTTGKPPAPPQPGGPAPGR_

Background Information for CLASRP:





Protein-protein Interactions for CLASRP

Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait SNW1 Cat. description Hein, Mann, Cell 2015
Category members IP bait C16orf80 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CLASRP Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait CLK2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait JPH4 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait LUC7L Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait PIP4K2A Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait SNIP1 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait TMEM184B Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait U2AF2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait WSB2 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in CLASRP

Domain name Domain Description TC-NER relevance -log10(p-value)
Category members SWAP_N_domain IPR019147 0


Protein complexes (CORUM database) featuring CLASRP

Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring CLASRP

Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0008380 RNA splicing Database 10.77
Category members GO Category GO:0006397 mRNA processing Database 3.76


© Copyright Svejstrup Laboratory 2015