bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »

bioLOGIC Data

bioLOGIC Data


Exact search


Query: CEP97

RNAi screen result RNAPII IP (PI) CSB IP CSB IP (PI) Chrom. Chrom. (PI) Phosphorylation Ubiquitylation
W
[Click on the plots to view the data selection in the respective scatterplot]

Protein Results:

 Results for post-translational modifications: see below | Red/green: hit at lower/upper end of the respective screen
Gene name Point score Z-score sums RNAi high RNAi low RNAPII-IP (PI) CSB-IP CSB-IP (PI) Chrom. Chrom. (PI)
CEP97 0 -0.765 -0.160 0.960

PTM Sites:

 Back to Protein Results | Red/green: hit at lower/upper end of the respective screen
Gene name PTM type PTM site UV UV (PI) Sequence
CEP97 Ubiquitylation K582 -0.776 -0.455 _NYNPQAK(gl)DVR_
CEP97 Phosphorylation S825 -0.818 -0.474 _LHIACFPVQLDTLSDGASVDESHGIS(ph)PPLQGEISQTQENSK_
CEP97 Phosphorylation S416 -0.019 -1.063 _NDLHLEDIQTDEDKLNCSLLSSESTFMPVASGLSPLS(ph)PTVELR_

Background Information for CEP97:


Pubmed-CEP97 »
Uniprot-CEP97 »
Biogrid-CEP97 »
ProteomicsDB-CEP97 »

Tumorportal-CEP97 »
COSMIC-CEP97 »
GenomeRNAi-CEP97 »
Genecards-CEP97


Protein-protein Interactions for CEP97
Show screen data for Category Name and Description Link to cat description Data Source
Category members IP bait CCP110 Cat. description Hein, Mann, Cell 2015
Category members IP bait CEP104 Cat. description Hein, Mann, Cell 2015
Category members IP bait CEP120 Cat. description Hein, Mann, Cell 2015
Category members IP bait CEP290 Cat. description Hein, Mann, Cell 2015
Category members IP bait KIF24 Cat. description Hein, Mann, Cell 2015
Category members IP bait LTN1 Cat. description Hein, Mann, Cell 2015
Category members IP bait NEDD1 Cat. description Hein, Mann, Cell 2015
Category members IP bait CDC16 Cat. description BioPlex, Huttlin, Gygi, Cell 2015
Category members IP bait RASSF7 Cat. description BioPlex, Huttlin, Gygi, Cell 2015


Protein Domains in CEP97
Domain name Domain Description TC-NER relevance -log10(p-value)
Category members P-loop_NTPase IPR027417 2.83
Category members IQ_motif_EF-hand-BS IPR000048 0


Protein complexes (CORUM database) featuring CEP97
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)


Categories featuring CEP97
Category Type Category ID Category Name Data Source TC-NER relevance -log10(p-value)
Category members GO Category GO:0005515 protein binding Database INF
Category members GO Category GO:0005634 nucleus Database INF
Category members GO Category GO:0005737 cytoplasm Database 12.81
Category members GO Category GO:0005813 centrosome Database 0.75
Category members GO Category GO:0005516 calmodulin binding Database 0.74
Category members GO Category GO:0030030 cell projection organization Database 0


.

© Copyright Svejstrup Laboratory 2015