Results for the Category
negative regulation of focal adhesion assembly
(GO:0051895)
| RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
| W | |||||||
| Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
|---|---|---|---|---|---|---|---|---|
| DMTN | 0 | 0.810 | -0.530 | |||||
| SRC | 0 | 0.050 | 0.470 | -0.031 |
| Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
|---|---|---|---|---|---|
| DMTN | Phosphorylation | S26 | 0.446 | 0.434 | _DSSVPGS(ph)PSSIVAK_ |
| DMTN | Phosphorylation | S29 | 0.762 | _DSSVPGSPSS(ph)IVAK_ | |
| DMTN | Phosphorylation | S92 | -0.084 | _STS(ph)PPPS(ph)PEVWADSR_ | |
| DMTN | Phosphorylation | S96 | 0.117 | -0.084 | _STS(ph)PPPS(ph)PEVWADSR_ |
| SRC | Phosphorylation | S17 | -0.604 | -0.689 | _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_ |
| SRC | Phosphorylation | S75 | 0.060 | 0.331 | _LFGGFNSSDTVTS(ph)PQR_ |
.
© Copyright Svejstrup Laboratory 2015