bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
regulation of vascular permeability
(GO:0043114)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
YES1 0 0.340 -0.470 0.295 0.576
SRC 0 0.050 0.470 -0.031

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_
YES1 Phosphorylation T37 -0.435 _YRPENTPEPVSTSVSHYGAEPT(ph)TVSPCPSSSAK_
YES1 Ubiquitylation K191 -0.112 0.264 _ESETTK(gl)GAYSLSIR_
YES1 Ubiquitylation K235 0.323 _AQFDTLQK(gl)LVK_
YES1 Ubiquitylation K259 -1.613 _LTTVCPTVK(gl)PQTQGLAK_


© Copyright Svejstrup Laboratory 2015