bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
tryptophan transport
(GO:0015827)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
SLC3A2 0 -0.520 0.660 0.690 1.007 -1.149 0.607 0.589

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
SLC3A2 Phosphorylation S103 0.947 _(ac)S(ph)QDTEVDMKEVELNELEPEK_
SLC3A2 Phosphorylation T106 1.017 _(ac)S(ph)QDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEK_
SLC3A2 Ubiquitylation K145 1.389 0.982 _NGLVK(gl)IK_
SLC3A2 Ubiquitylation K147 1.147 0.705 _IK(gl)VAEDEAEAAAAAK_
SLC3A2 Ubiquitylation K160 -0.471 _VAEDEAEAAAAAK(gl)FTGLSK_
SLC3A2 Ubiquitylation K166 -0.293 0.631 _FTGLSK(gl)EELLK_


© Copyright Svejstrup Laboratory 2015