Results for the Category
positive regulation of protein transport
(GO:0051222)
| RNAi screen result | RNAPII IP (MG132) | CSB IP | CSB IP (MG132) | Chrom. | Chrom. (MG132) | Ubi /Phospo | Ubi /Phospho (MG132) |
| W | |||||||
| Gene name | MGoogle Score | RNAi high | RNAi low | RNAPII-IP (MG132) | CSB-IP | CSB-IP (MG132) | Chrom. | Chrom. (MG132) |
|---|---|---|---|---|---|---|---|---|
| PRKCZ | 0 | -0.290 | 0.310 | |||||
| LRP1 | 0 | -0.360 | 0.400 | 1.199 | 1.016 | |||
| CHP1 | 0 | 0.130 | 0.190 | -0.105 | 0.192 |
| Gene name | PTM type | PTM site | UV | UV (MG132) | Sequence |
|---|---|---|---|---|---|
| LRP1 | Ubiquitylation | K4527 | -0.315 | _HSLASTDEK(gl)R_ | |
| PRKCZ | Phosphorylation | T560 | -0.884 | -1.578 | _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_ |
.
© Copyright Svejstrup Laboratory 2015