bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
PID_SMAD2_3NUCLEAR_PATHWAY
(Pathway_845)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
JUN 3 -0.930 0.930 -0.126
HSPA8 2 -0.640 0.320 0.616 0.207 0.569 0.697 0.187
ATF2 2 -1.380 1.800
FOXO3 2 -0.410 -0.120
RBL1 1 0.270 -0.950
KAT2B 1 -0.980 2.090
HDAC1 1 -1.980 4.450
HDAC1 1 -1.980 4.450 -0.122 0.307 0.969 0.094 0.191
NCOA2 1 -0.210 -0.230
SKI 1 -1.870 2.800 -1.139 -0.588
RBBP4 1 2.110 -1.240 0.533 -0.610 0.648
SNIP1 1 1.160 -0.620
SP3 1 2.510 -0.930 -0.403 0.807 0.836
HDAC2 1 -2.390 4.970
HDAC2 1 -2.390 4.970 0.187 -0.007 0.825
CREBBP 0 0.840 -0.950 -3.889 -1.071
RUNX3 0 -0.550 0.450
CBFB 0 1.550 -0.600
TCF3 0 0.270 -0.020
MEF2C 0 -0.980 1.550
MEF2C 0 -0.980 1.550
NCOA1 0 1.240 -0.460
EP300 0 -1.210 1.320 -1.089 -1.694 -0.723
RBBP7 0 -0.080 -0.020 0.602 0.336 0.890 0.363 0.402
RBBP7 0 -0.080 -0.020 0.397 0.000 0.776
RBBP7 0 -0.080 -0.020
PIAS4 0 -1.510 2.250 -1.454
GATA3 0 0.000 -0.660
NR3C1 0 0.390 -0.260
ZBTB17 0 0.670 -0.540
CREB1 0 1.080 -0.800 -1.027
CDK2 0 -0.040 -0.300 -0.578 -0.797
CDK2 0 -0.040 -0.300 -0.202 -0.884 -0.107 -0.097 -0.501
CDKN1A 0 1.080 -0.750
RUNX2 0
MAX 0 -0.780 0.530 -0.276 0.290
MAX 0 -0.780 0.530
SIN3B 0 0.040 -0.220 0.475 0.416
CDK4 0 1.930 -0.950
CDK4 0 1.930 -0.950 -0.510 0.013
LAMC1 0 0.650 -1.240 -0.164 0.459
MYC 0 0.170 0.550 -2.443 -0.949 -0.454 -1.290
NCOR1 0 -0.820 1.130 -0.827 -0.215 0.037
SMAD4 0 0.420 -0.390 0.020 0.556 -0.485
AKT1 0 -0.050 0.700
AKT1 0 0.860 -0.040
DLX1 0 -1.110 0.780
DLX1 0 -1.110 0.780 -1.286 0.204
SAP18 0 -0.040 0.100
SAP18 0 -0.040 0.100 0.734 0.370 -0.445
CTBP1 0 -0.410 0.390
CTBP1 0 -0.410 0.390 -0.293 -0.875 0.361 0.407 -0.049
CTBP1 0 -0.410 0.390 1.494 -0.398 0.504 0.897 -0.123
ATF3 0 0.740 -0.540
SAP30 0 -0.180 0.110 -0.538 0.864
SMAD3 0 -1.560 1.800
SMAD3 0 0.270 -0.340
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410
CEBPB 0 0.400 -0.930
SMAD2 0
FOXL1 0 0.560 -0.350 -1.217 -0.424 0.659
NKX2-5 0 -0.150 1.230 0.174 0.236
NKX2-5 0 -0.150 1.230 -0.123
SP1 0 0.404 0.333 0.650
TFDP1 0 -0.430 0.060 -1.111 0.446 -1.279 -0.496
E2F4 0 0.930 -0.810

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
AKT1 Phosphorylation S124 0.252 0.311 _SGS(ph)PSDNSGAEEMEVSLAKPK_
AKT1 Phosphorylation S126 -0.241 _SGSPS(ph)DNSGAEEM(ox)EVSLAK_
AKT1 Ubiquitylation K301 0.988 _EGIK(gl)DGATMK_
ATF2 Phosphorylation T71 -1.263 -1.166 _NDSVIVADQTPT(ph)PTR_
ATF2 Phosphorylation S90 2.624 2.389 _NCEEVGLFNELAS(ph)PFENEFKK_
ATF2 Phosphorylation S112 1.025 1.118 _MPLDLS(ph)PLATPIIR_
ATF3 Phosphorylation T162 1.218 _AQNGRT(ph)PEDERNLFIQQIK_
CBFB Ubiquitylation K28 0.486 0.548 _ECEIK(gl)YTGFR_
CDK2 Ubiquitylation K6 -0.130 -0.399 _(ac)MENFQK(gl)VEK_
CDK2 Ubiquitylation K6 0.011 -0.784 _(ac)M(ox)EDYTK(gl)IEK_
CDK2 Phosphorylation T14 0.429 _IGEGT(ph)YGVVYK_
CDK2 Phosphorylation Y15 0.697 0.743 _IGEGTY(ph)GVVYK_
CDK2 Ubiquitylation K20 0.272 _IGEGTYGVVYK(gl)AR_
CDK2 Ubiquitylation K20 -0.327 -0.270 _IGEGTYGVVYK(gl)GR_
CDK2 Ubiquitylation K24 0.366 _NK(gl)LTGEVVALKK_
CDK2 Ubiquitylation K33 0.033 _NKLTGEVVALK(gl)K_
CDK2 Ubiquitylation K33 0.736 0.239 _TTGQVVAMK(gl)K_
CDK2 Ubiquitylation K34 0.542 _LTGEVVALKK(gl)_
CDK2 Ubiquitylation K34 -0.306 _TTGQVVAMKK(gl)_
CDK2 Ubiquitylation K58 0.312 -0.262 _EISLLK(gl)ELR_
CDK2 Ubiquitylation K136 -0.468 _DLK(gl)PQNLLIDDK(gl)GTIK_
CDK2 Ubiquitylation K145 0.161 -0.954 _DLKPQNLLIDDK(gl)GTIK_
CDK2 Ubiquitylation K149 -0.038 _GTIK(gl)LADFGLAR_
CDK2 Ubiquitylation K251 -0.047 -1.236 _WK(gl)PGSLASHVK_
CDK2 Ubiquitylation K280 0.179 -1.210 _MLIYDPAK(gl)R_
CDK2 Ubiquitylation K298 -1.907 -2.380 _QDFSK(gl)VVPPLDEDGR_
CDK4 Ubiquitylation K142 -0.552 _DLK(gl)PENILVTSGGTVK_
CDK4 Ubiquitylation K211 -0.101 _K(gl)PLFCGNSEADQLGK_
CDK4 Phosphorylation S236 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Phosphorylation S249 0.095 _QDDS(ph)PSGASYGQDYDLS(ph)PSR_
CDK4 Ubiquitylation K297 0.247 0.052 _ALQHSYLHK(gl)DEGNPE_
CDK4 Phosphorylation S385 0.649 _HSSIS(ph)PVRLPLNSSLGAELSR_
CDK4 Phosphorylation S420 0.004 -0.202 _ES(ph)KGSPVFLPR_
CDK4 Phosphorylation S423 -0.155 -0.297 _GS(ph)PVFLPR_
CDK4 Phosphorylation T514 0.364 0.570 _DSKPIALKEEIVT(ph)PK_
CDK4 Phosphorylation S681 -2.532 -2.051 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation S685 -2.729 _HLLTDLPLPPELPGGDLS(ph)PPDS(ph)PEPK_
CDK4 Phosphorylation T692 -0.765 -1.849 _AIT(ph)PPQQPYK_
CDK4 Phosphorylation S1082 -1.661 -0.980 _KETTSGTSTEPVKNS(ph)SPAPPQPAPGK_
CDK4 Phosphorylation S1083 -1.093 -1.330 _NSS(ph)PAPPQPAPGK_
CDK4 Phosphorylation T1244 -0.956 _RT(ph)PTMPQEEAAACPPHILPPEK_
CDKN1A Ubiquitylation K188 -2.505 -1.077 _QTSMTDFYHSK(gl)R_
CEBPB Phosphorylation S231 -0.660 _AYLGYQAVPSGSSGSLSTSSSSS(ph)PPGTPSPADAK_
CREB1 Phosphorylation S271 -0.979 -1.450 _TAPTSTIAPGVVM(ox)ASS(ph)PALPTQPAEEAAR_
CREB1 Ubiquitylation K333 1.343 _ALK(gl)DLYCHK_
CREBBP Phosphorylation S2093 0.037 0.097 _SIS(ph)PSALQDLLR_
CTBP1 Ubiquitylation K279 0.443 _GGLVDEK(gl)ALAQALK_
CTBP1 Ubiquitylation K286 0.130 0.008 _ALAQALK(gl)EGR_
CTBP1 Phosphorylation S492 -1.548 _YPPGIVGVAPGGLPAAM(ox)EGIIPGGIPVTHNLPTVAHPS(ph)QAPSPNQPTK_
DLX1 Phosphorylation S9 0.286 0.248 _(ac)M(ox)TM(ox)TTM(ox)PES(ph)LNSPVSGK_
DLX1 Phosphorylation S225 -0.821 _SGEIPSEQHPGAS(ph)AS(ph)PPCASPPVSAPASWDFGVPQR_
DLX1 Phosphorylation S227 -1.137 _SGEIPSEQHPGASAS(ph)PPCAS(ph)PPVSAPASWDFGVPQR_
DLX1 Phosphorylation S232 -1.137 _SGEIPSEQHPGASAS(ph)PPCAS(ph)PPVSAPASWDFGVPQR_
E2F4 Phosphorylation T14 -2.100 _(ac)AEAGPQAPPPPGT(ph)PSR_
E2F4 Phosphorylation S16 -2.158 -1.655 _(ac)AEAGPQAPPPPGTPS(ph)R_
EP300 Phosphorylation S1038 -0.672 -0.349 _TEIKEEEDQPSTSATQSS(ph)PAPGQSK_
EP300 Phosphorylation S1726 0.994 0.627 _LGLGLDDESNNQQAAATQS(ph)PGDSRR_
EP300 Phosphorylation S2328 -1.092 0.725 _PQSQPPHSSPS(ph)PR_
FOXL1 Phosphorylation S6 0.325 0.055 _YS(ph)VSSPNSLGVVPYLGGEQSYYR_
FOXL1 Phosphorylation S235 -1.239 _TENGTCPS(ph)PPQPLS(ph)PAAALGSGSAAAVPK_
FOXL1 Phosphorylation S241 -1.239 _TENGTCPS(ph)PPQPLS(ph)PAAALGSGSAAAVPK_
FOXL1 Phosphorylation S259 -0.376 -0.198 _IES(ph)PDSSSSSLSSGSSPPGSLPSAR_
FOXL1 Phosphorylation S320 0.313 0.178 _GS(ph)PQSAAAELSSGLLASAAASSR_
FOXL1 Phosphorylation S323 0.347 _GSPQS(ph)AAAELSSGLLASAAASSR_
FOXL1 Ubiquitylation K554 -0.030 0.013 _TSGAFVYDCSK(gl)F_
FOXO3 Phosphorylation S12 -1.324 _(ac)AEAPASPAPLS(ph)PLEVELDPEFEPQSRPR_
FOXO3 Phosphorylation S253 2.510 _AVS(ph)MDNSNKYTK_
FOXO3 Phosphorylation S284 4.138 6.011 _AALQTAPESADDS(ph)PSQLSK_
FOXO3 Phosphorylation S421 1.295 _GS(ph)GLGSPTSSFNSTVFGPSSLNSLR_
FOXO3 Phosphorylation S425 1.471 _GSGLGS(ph)PTSSFNSTVFGPSSLNSLR_
GATA3 Phosphorylation S162 -1.195 -0.563 _DVS(ph)PDPSLSTPGSAGSAR_
HDAC1 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC1 Ubiquitylation K66 -0.593 _ANAEEMTK(gl)YHSDDYIK_
HDAC1 Ubiquitylation K74 0.620 -1.473 _YHSDDYIK(gl)FLR_
HDAC1 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC1 Phosphorylation S393 -1.133 -1.144 _M(ox)LPHAPGVQM(ox)QAIPEDAIPEES(ph)GDEDEDDPDKR_
HDAC1 Phosphorylation S409 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Phosphorylation S410 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Ubiquitylation K412 0.642 -0.744 _ISICSSDK(gl)R_
HDAC2 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC2 Ubiquitylation K67 -0.467 _ATAEEMTK(gl)YHSDEYIK_
HDAC2 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC2 Ubiquitylation K284 0.749 _GHAK(gl)CVEVVK_
HDAC2 Phosphorylation S394 -0.865 -0.997 _M(ox)LPHAPGVQM(ox)QAIPEDAVHEDS(ph)GDEDGEDPDKR_
HDAC2 Phosphorylation S422 0.482 0.781 _IACDEEFS(ph)DSEDEGEGGR_
HSPA8 Ubiquitylation K3 -0.324 _(ac)SK(gl)GPAVGIDLGTTYSCVGVFQHGK_
HSPA8 Ubiquitylation K56 -0.260 1.224 _LIGDAAK(gl)NQVAMNPTNTVFDAK(gl)R_
HSPA8 Ubiquitylation K71 0.041 1.713 _NQVAM(ox)NPTNTVFDAK(gl)R_
HSPA8 Ubiquitylation K108 0.301 0.877 _VQVEYK(gl)GETK_
HSPA8 Ubiquitylation K126 -0.071 0.472 _SFYPEEVSSMVLTK(gl)MK_
HSPA8 Ubiquitylation K128 1.160 0.420 _MK(gl)EIAEAYLGK_
HSPA8 Ubiquitylation K159 0.192 2.025 _QATK(gl)DAGTIAGLNVLR_
HSPA8 Ubiquitylation K187 0.744 _IINEPTAAAIAYGLDK(gl)K_
HSPA8 Ubiquitylation K188 -0.076 0.744 _IINEPTAAAIAYGLDKK(gl)_
HSPA8 Ubiquitylation K319 0.026 -0.313 _GTLDPVEK(gl)ALR_
HSPA8 Ubiquitylation K325 0.501 -0.341 _ALRDAK(gl)LDK_
HSPA8 Ubiquitylation K328 -0.057 0.670 _LDK(gl)SQIHDIVLVGGSTR_
HSPA8 Ubiquitylation K348 0.390 3.929 _IQK(gl)LLQDFFNGK_
HSPA8 Ubiquitylation K357 0.339 _LLQDFFNGK(gl)ELNK_
HSPA8 Ubiquitylation K451 0.095 0.846 _AMTK(gl)DNNLLGK_
HSPA8 Ubiquitylation K497 0.354 0.667 _STGK(gl)ENKITITNDK_
HSPA8 Ubiquitylation K500 0.066 1.038 _ENK(gl)ITITNDK_
HSPA8 Ubiquitylation K507 -0.228 -0.104 _ITITNDK(gl)GR_
HSPA8 Ubiquitylation K512 0.321 0.692 _LSK(gl)EDIER_
HSPA8 Ubiquitylation K524 0.032 -0.180 _M(ox)VQEAEK(gl)YKAEDEKQR_
HSPA8 Ubiquitylation K526 4.133 0.230 _MVQEAEKYK(gl)AEDEK_
HSPA8 Ubiquitylation K531 1.093 _MVQEAEK(gl)YKAEDEK(gl)QR_
HSPA8 Ubiquitylation K539 -0.121 0.409 _VSSK(gl)NSLESYAFNMK_
HSPA8 Ubiquitylation K557 -0.270 _ATVEDEK(gl)LQGK_
HSPA8 Ubiquitylation K597 0.282 _NQTAEKEEFEHQQK(gl)ELEK_
HSPA8 Ubiquitylation K601 0.005 0.196 _ELEK(gl)VCNPIITK_
JUN Phosphorylation S58 -0.167 -1.247 _AKNS(ph)DLLTSPDVGLLK_
JUN Phosphorylation T62 2.545 1.674 _NSDLLT(ph)SPDVGLLK_
JUN Phosphorylation S63 2.030 1.458 _NSDLLTS(ph)PDVGLLK_
JUN Ubiquitylation K70 9.213 _NSDLLTSPDVGLLK(gl)_
JUN Phosphorylation S73 1.499 0.845 _LAS(ph)PELER_
JUN Phosphorylation S243 -0.642 -1.399 _LQALKEEPQTVPEMPGETPPLS(ph)PIDMESQER_
JUN Ubiquitylation K309 1.034 0.155 _EQVAQLK(gl)QK_
KAT2B Phosphorylation S117 2.088 _NPNPS(ph)PTPPR_
LAMC1 Ubiquitylation K564 0.404 _YFIAPAK(gl)FLGK_
MAX Phosphorylation S2 0.341 -0.060 _(ac)S(ph)DNDDIEVES(ph)DEEQPR_
MAX Phosphorylation S2 0.510 0.568 _(ac)S(ph)DNDDIEVESDADKR_
MAX Phosphorylation S11 0.341 -0.060 _(ac)S(ph)DNDDIEVES(ph)DEEQPR_
MAX Phosphorylation S11 -0.408 0.069 _(ac)S(ph)DNDDIEVES(ph)DADKR_
MAX Ubiquitylation K57 -0.903 0.246 _DSVPSLQGEK(gl)ASR_
MEF2C Ubiquitylation K23 -0.140 _QVTFTK(gl)R_
MEF2C Phosphorylation S240 0.008 0.302 _NS(ph)PGLLVSPGNLNK_
MEF2C Phosphorylation S406 0.272 0.338 _SEPVS(ph)PPRDR_
MYC Phosphorylation S20 -1.444 -1.145 _PLNVS(ph)FTNR_
MYC Phosphorylation T72 -1.699 -1.813 _FELLPT(ph)PPLS(ph)PSRR_
MYC Phosphorylation S76 -1.777 -1.435 _FELLPTPPLS(ph)PSR_
MYC Phosphorylation S81 0.459 _S(ph)GLCSPSYVAVTPFSLR_
MYC Phosphorylation S85 0.199 0.073 _SGLCS(ph)PSYVAVTPFSLR_
MYC Ubiquitylation K162 -2.475 -1.259 _LVSEK(gl)LASYQAAR_
MYC Phosphorylation S295 -0.903 _SESGS(ph)PSAGGHSKPPHSPLVLK_
MYC Phosphorylation S307 -1.486 _SES(ph)GSPSAGGHSKPPHS(ph)PLVLK_
MYC Ubiquitylation K340 -2.449 _VK(gl)LDSVR_
MYC Ubiquitylation K403 -3.432 _DQIPELENNEK(gl)APK_
NCOA1 Phosphorylation S22 0.503 0.810 _KGS(ph)PCDTLASSTEK_
NCOA2 Phosphorylation S699 -0.159 -0.104 _LLQDSSS(ph)PVDLAK_
NCOA2 Phosphorylation S771 1.654 0.621 _LDS(ph)KTDPASNTK_
NCOR1 Phosphorylation S1195 -0.029 0.716 _MPIEDS(ph)SPEKGREEAASK_
NCOR1 Phosphorylation S1196 0.087 0.141 _MPIEDSS(ph)PEKGR_
NCOR1 Phosphorylation S1472 0.700 0.536 _AQLS(ph)PGIYDDTSAR_
NCOR1 Phosphorylation S1977 -0.959 -0.974 _YETPSDAIEVIS(ph)PASSPAPPQEK_
NCOR1 Ubiquitylation K1998 -2.086 _LQTYQPEVVK(gl)ANQAENDPTR_
NCOR1 Phosphorylation S2120 0.148 0.154 _VS(ph)PENLVDK_
NCOR1 Phosphorylation S2151 -1.006 -0.922 _SHVSSEPYEPIS(ph)PPQVPVVHEK_
NCOR1 Phosphorylation S2184 0.120 0.226 _S(ph)PGSISYLPSFFTK_
NCOR1 Phosphorylation S2187 0.396 _SPGS(ph)ISYLPSFFTK_
NR3C1 Phosphorylation S45 -0.810 -0.399 _VSASS(ph)PSLAVASQSDSK_
NR3C1 Phosphorylation S226 -0.070 _SDLLIDENCLLS(ph)PLAGEDDSFLLEGNSNEDCKPLILPDTKPK_
NR3C1 Ubiquitylation K696 0.338 _MTYIK(gl)ELGK_
PIAS4 Ubiquitylation K57 0.068 -0.936 _ALQLVQFDCSPELFKK(gl)_
PIAS4 Ubiquitylation K125 -2.654 _LPAK(gl)TLKPEVR_
PIAS4 Ubiquitylation K330 -1.699 _VSLICPLVK(gl)MR_
RBBP4 Ubiquitylation K4 0.699 0.574 _(ac)ADK(gl)EAAFDDAVEER_
RBBP4 Ubiquitylation K160 -1.765 _HPSK(gl)PDPSGECNPDLR_
RBBP7 Phosphorylation S3 1.036 1.447 _(ac)AS(ph)KEMFEDTVEER_
RBBP7 Ubiquitylation K4 0.122 -0.804 _(ac)ASK(gl)EMFEDTVEER_
RBBP7 Ubiquitylation K21 0.081 -0.004 _VINEEYK(gl)IWK_
RBBP7 Phosphorylation S145 0.319 1.248 _TPS(ph)SDVLVFDYTK_
RBBP7 Ubiquitylation K159 -1.249 -3.808 _HPAK(gl)PDPSGECNPDLR_
RBBP7 Ubiquitylation K214 -0.021 _EGK(gl)IVDAK_
RBBP7 Ubiquitylation K236 0.469 _DSSVK(gl)LYQTR_
RBL1 Phosphorylation S640 -0.916 -1.810 _DMQPLS(ph)PISVHER_
RBL1 Phosphorylation S749 0.935 1.566 _VKS(ph)PVSLTAHSLIGASPK_
RBL1 Ubiquitylation K885 -0.844 _SVLLK(gl)SIPR_
RUNX2 Phosphorylation S96 0.504 -0.399 _RFS(ph)PPSSSLQPGK_
RUNX2 Ubiquitylation K244 0.258 _NASAVMK(gl)NQVAR_
RUNX3 Ubiquitylation K244 0.258 _NASAVMK(gl)NQVAR_
SAP18 Ubiquitylation K88 0.323 0.511 _ELTSLVK(gl)EVYPEAR_
SAP18 Ubiquitylation K128 0.956 0.189 _K(gl)GTDDSMTLQSQK_
SAP30 Ubiquitylation K214 -0.201 -0.160 _SDLK(gl)VDSGVH_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_
SIN3B Phosphorylation S1003 0.432 _YVEQYVGTEGASSS(ph)PTEGFLLKPVFLQR_
SKI Ubiquitylation K294 -0.126 -0.054 _AYILLSQDYTGK(gl)EEQAR_
SKI Ubiquitylation K365 -0.244 -0.390 _TLAGSSNK(gl)SLGCVHPR_
SKI Phosphorylation S431 -0.475 _VVS(ph)SPPCAAAVSR_
SKI Phosphorylation S432 -0.742 -0.438 _VVSS(ph)PPCAAAVSR_
SKI Phosphorylation S480 -1.160 -1.491 _LTVDTPGAPETLAPVAAPEEDKDS(ph)EAEVEVESR_
SMAD2 Phosphorylation T8 -0.896 -0.885 _(ac)SSILPFT(ph)PPVVK_
SMAD2 Ubiquitylation K13 -0.058 _(ac)SSILPFTPPVVK(gl)R_
SMAD3 Ubiquitylation K13 -0.704 _(ac)SSILPFTPPIVK(gl)R_
SNIP1 Phosphorylation S35 -0.473 -0.436 _QERLS(ph)PEVAPPAHR_
SNIP1 Phosphorylation S49 -0.946 _RPDHS(ph)GGSPSPPTSEPAR_
SNIP1 Phosphorylation S52 -1.157 -1.156 _RPDHSGGS(ph)PSPPTSEPAR_
SNIP1 Phosphorylation S153 0.008 0.248 _RTS(ph)NERPGSGQGQGR_
SNIP1 Phosphorylation S200 2.205 _NDVGGGGS(ph)ESQELVPRPGGNNK_
SNIP1 Phosphorylation S202 2.205 _NDVGGGGS(ph)ESQELVPRPGGNNK_
SP1 Phosphorylation S2 0.834 1.114 _(ac)S(ph)DQDHSMDEMTAVVK_
SP1 Phosphorylation S7 0.586 0.217 _(ac)SDQDHS(ph)MDEMTAVVK_
SP1 Phosphorylation S56 -0.154 _SSSTGSSSSTGGGGQES(ph)QPSPLALLAATCSR_
SP1 Phosphorylation S59 -0.217 -0.135 _SSSTGSSSSTGGGGQESQPS(ph)PLALLAATCSR_
TCF3 Phosphorylation S328 0.865 0.756 _AGAPGALS(ph)PSYDGGLHGLQSK_
TFDP1 Phosphorylation S23 -0.667 -0.353 _VFIDQNLS(ph)PGK_
TFDP1 Ubiquitylation K320 -0.549 0.052 _MGMACGLESGSCSAEDLK(gl)MAR_
ZBTB17 Phosphorylation T119 -0.130 -0.375 _SLAEPAT(ph)SPGGNAEALATEGGDK_
ZBTB17 Phosphorylation S120 -0.091 -0.316 _SLAEPATS(ph)PGGNAEALATEGGDK_


© Copyright Svejstrup Laboratory 2015