bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
PID_NFKAPPAB_ATYPICAL_PATHWAY
(Pathway_610)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
MAPK14 2 -0.160 -0.350
CSNK2A2 1 -2.450 5.260 1.102 -0.224 1.364 -0.368 -0.150
ARRB2 1 2.000 -1.160 -0.340 0.096 0.051 -1.604
CSNK2A1 0 0.050 -0.020 0.030 -0.550 1.362 0.022 -0.045
IKBKB 0 0.400 0.610
NFKB1 0 0.720 -0.810
PIK3CA 0
PIK3R1 0 1.910 -1.220 -0.441 0.147
RELA 0 -1.130 1.600 0.793
LCK 0 -0.490 1.390 0.295 0.576
SRC 0 0.050 0.470 -0.031
CSNK2B 0 1.680 -0.760 0.254 -0.316 1.419 -0.407 -0.001

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
ARRB2 Ubiquitylation K199 -1.933 _VQFAPEK(gl)PGPQPSAETTR_
CSNK2A1 Ubiquitylation K71 0.008 _ILK(gl)PVKK_
CSNK2A1 Ubiquitylation K329 -0.661 -0.889 _EAMEHPYFYTVVK(gl)DQAR_
CSNK2B Phosphorylation S224 0.032 0.181 _IHPM(ox)AYQLQLQAAS(ph)NFKSPVK_
CSNK2B Phosphorylation S228 0.032 -0.025 _IHPM(ox)AYQLQLQAASNFKS(ph)PVK_
CSNK2B Ubiquitylation K231 -1.221 _SPVK(gl)TIR_
IKBKB Ubiquitylation K106 0.253 _K(gl)YLNQFENCCGLR_
IKBKB Phosphorylation S672 0.670 0.244 _GPVSGS(ph)PDSMNASR_
LCK Phosphorylation T37 -0.435 _YRPENTPEPVSTSVSHYGAEPT(ph)TVSPCPSSSAK_
LCK Ubiquitylation K191 -0.112 0.264 _ESETTK(gl)GAYSLSIR_
LCK Ubiquitylation K235 0.323 _AQFDTLQK(gl)LVK_
LCK Ubiquitylation K259 -1.613 _LTTVCPTVK(gl)PQTQGLAK_
MAPK14 Phosphorylation S2 3.221 3.623 _(ac)S(ph)QERPTFYR_
MAPK14 Phosphorylation T180 0.958 1.087 _HTDDEM(ox)T(ph)GYVATR_
MAPK14 Phosphorylation Y182 1.388 1.374 _HTDDEM(ox)TGY(ph)VATR_
MAPK14 Ubiquitylation K249 0.073 -1.380 _LVGTPGAELLKK(gl)_
NFKB1 Phosphorylation S907 -0.025 0.113 _TTSQAHSLPLS(ph)PASTR_
PIK3CA Ubiquitylation K864 0.390 0.588 _NSHTIM(ox)QIQCK(gl)GGLK_
PIK3CA Ubiquitylation K868 0.204 0.651 _NSHTIM(ox)QIQCKGGLK(gl)_
PIK3CA Ubiquitylation K974 -0.273 _GAQECTK(gl)TREFER_
SRC Phosphorylation S17 -0.604 -0.689 _S(ph)LEPAENVHGAGGGAFPASQTPSKPASADGHR_
SRC Phosphorylation S75 0.060 0.331 _LFGGFNSSDTVTS(ph)PQR_


© Copyright Svejstrup Laboratory 2015