bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
OPR_PB1
(IPR000270)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
PRKCZ 0 -0.290 0.310
TFG 0 0.490 -0.380
TFG 0 0.490 -0.380 2.238
PARD6B 0 -1.070 1.470
SQSTM1 0 -0.860 1.770 -2.165 -2.063 -1.741
SQSTM1 0 -0.440 0.530 -2.165 -2.063 -1.741
PRKCI 0 0.730 -0.460 1.483 0.192 0.350
MAP3K2 0 -1.220 1.960
NBR1 0 0.470 -0.040 -2.408
MAP3K3 0 0.830 -0.050

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
MAP3K2 Phosphorylation S153 0.506 -0.231 _RLS(ph)IIGPTSR_
MAP3K2 Phosphorylation S163 -0.910 -0.776 _DRS(ph)SPPPGYIPDELHQVAR_
MAP3K2 Phosphorylation S164 -0.743 -0.966 _DRS(ph)SPPPGYIPDELHQVAR_
MAP3K2 Phosphorylation S239 -0.284 -0.618 _AQS(ph)YPDNHQEFSDYDNPIFEK_
MAP3K2 Phosphorylation S331 0.008 _RRGS(ph)DIDNPTLTVM(ox)DISPPSR_
MAP3K3 Phosphorylation S166 -0.325 _HLS(ph)VSSQNPGR_
MAP3K3 Phosphorylation S175 0.120 -0.091 _S(ph)SPPPGYVPER_
MAP3K3 Phosphorylation S176 0.120 -0.091 _S(ph)SPPPGYVPER_
MAP3K3 Phosphorylation S250 -0.070 _AQS(ph)FPDNR_
NBR1 Ubiquitylation K464 -0.807 -2.087 _LSHK(gl)GQQFGPR_
NBR1 Ubiquitylation K515 -0.852 _TDDLTCQQEETFLLAK(gl)EER_
NBR1 Ubiquitylation K539 -0.515 -0.635 _QLGEVTEQTEGTAACIPQKAK(gl)_
NBR1 Ubiquitylation K627 -0.779 -1.425 _ALPDSMVSVK(gl)R_
NBR1 Ubiquitylation K767 -1.436 _GAEGK(gl)PGVEAGQEPAEAGER_
PARD6B Phosphorylation S11 0.746 0.842 _HGAGS(ph)GCLGTM(ox)EVK_
PRKCI Ubiquitylation K244 0.289 _ESGK(gl)ASSSLGLQDFDLLR_
PRKCI Ubiquitylation K488 -0.090 0.847 _SLSVK(gl)AASVLK_
PRKCZ Phosphorylation T560 -0.884 -1.578 _KQALPPFQPQITDDYGLDNFDTQFTSEPVQLT(ph)PDDEDAIKR_
SQSTM1 Ubiquitylation K13 0.150 0.302 _AYLLGK(gl)EDAAR_
SQSTM1 Phosphorylation S28 -0.721 _RFSFCCS(ph)PEPEAEAEAAAGPGPCER_
SQSTM1 Ubiquitylation K141 -0.915 _YK(gl)CSVCPDYDLCSVCEGK_
SQSTM1 Ubiquitylation K157 -0.852 -0.677 _CSVCPDYDLCSVCEGK(gl)GLHR_
SQSTM1 Phosphorylation T269 -0.681 -0.421 _LT(ph)PVS(ph)PESSSTEEK_
SQSTM1 Phosphorylation S272 0.171 0.044 _LTPVS(ph)PESSSTEEK_
SQSTM1 Phosphorylation S332 -0.007 _IALESEGRPEEQMESDNCS(ph)GGDDDWTHLSSK_
SQSTM1 Ubiquitylation K420 -1.122 -0.061 _LLQTK(gl)NYDIGAALDTIQYSK_
SQSTM1 Ubiquitylation K435 -1.352 -0.780 _NYDIGAALDTIQYSK(gl)HPPPL_
TFG Ubiquitylation K47 0.052 _GK(gl)LLSNDEVTIK_
TFG Ubiquitylation K103 -0.145 -0.235 _PLESSQVK(gl)YLR_
TFG Phosphorylation S197 -0.758 -0.397 _NVM(ox)SAFGLTDDQVSGPPS(ph)APAEDR_


© Copyright Svejstrup Laboratory 2015