bioLOGIC Data » bioLOGIC CategoryView » bioLOGIC VennView » Experimental Details »
bioLOGIC Category

Results for the Category
NCOR2 complex
(1505)

RNAi screen result RNAPII IP (MG132) CSB IP CSB IP (MG132) Chrom. Chrom. (MG132) Ubi /Phospo Ubi /Phospho (MG132)
W

Protein Results:

Results for post-translational modifications (below)
Gene name MGoogle Score RNAi high RNAi low RNAPII-IP (MG132) CSB-IP CSB-IP (MG132) Chrom. Chrom. (MG132)
HDAC1 1 -1.980 4.450
HDAC1 1 -1.980 4.450 -0.122 0.307 0.969 0.094 0.191
NCOR2 1 1.850 -1.050
NCOR2 1 1.850 -1.050 0.037 -1.127
HDAC2 1 -2.390 4.970
HDAC2 1 -2.390 4.970 0.187 -0.007 0.825
NCOR1 0 -0.820 1.130 -0.827 -0.215 0.037
SAP30 0 -0.180 0.110 -0.538 0.864
SIN3A 0 -0.610 0.780 0.378 -0.208 0.304 -0.168 0.410
HDAC3 0 -0.790 1.070

PTM Sites:

Back to Protein Results
Gene name PTM type PTM site UV UV (MG132) Sequence
HDAC1 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC1 Ubiquitylation K66 -0.593 _ANAEEMTK(gl)YHSDDYIK_
HDAC1 Ubiquitylation K74 0.620 -1.473 _YHSDDYIK(gl)FLR_
HDAC1 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC1 Phosphorylation S393 -1.133 -1.144 _M(ox)LPHAPGVQM(ox)QAIPEDAIPEES(ph)GDEDEDDPDKR_
HDAC1 Phosphorylation S409 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Phosphorylation S410 1.326 1.144 _ISICS(ph)SDKR_
HDAC1 Ubiquitylation K412 0.642 -0.744 _ISICSSDK(gl)R_
HDAC2 Ubiquitylation K50 0.036 _K(gl)MEIYRPHK_
HDAC2 Ubiquitylation K67 -0.467 _ATAEEMTK(gl)YHSDEYIK_
HDAC2 Ubiquitylation K89 0.749 -0.241 _SIRPDNMSEYSK(gl)QMQR_
HDAC2 Ubiquitylation K284 0.749 _GHAK(gl)CVEVVK_
HDAC2 Phosphorylation S394 -0.865 -0.997 _M(ox)LPHAPGVQM(ox)QAIPEDAVHEDS(ph)GDEDGEDPDKR_
HDAC2 Phosphorylation S422 0.482 0.781 _IACDEEFS(ph)DSEDEGEGGR_
HDAC3 Phosphorylation S424 -0.354 _GPEENYSRPEAPNEFYDGDHDNDKES(ph)DVEI_
NCOR1 Phosphorylation S1195 -0.029 0.716 _MPIEDS(ph)SPEKGREEAASK_
NCOR1 Phosphorylation S1196 0.087 0.141 _MPIEDSS(ph)PEKGR_
NCOR1 Phosphorylation S1472 0.700 0.536 _AQLS(ph)PGIYDDTSAR_
NCOR1 Phosphorylation S1977 -0.959 -0.974 _YETPSDAIEVIS(ph)PASSPAPPQEK_
NCOR1 Ubiquitylation K1998 -2.086 _LQTYQPEVVK(gl)ANQAENDPTR_
NCOR1 Phosphorylation S2120 0.148 0.154 _VS(ph)PENLVDK_
NCOR1 Phosphorylation S2151 -1.006 -0.922 _SHVSSEPYEPIS(ph)PPQVPVVHEK_
NCOR1 Phosphorylation S2184 0.120 0.226 _S(ph)PGSISYLPSFFTK_
NCOR1 Phosphorylation S2187 0.396 _SPGS(ph)ISYLPSFFTK_
NCOR2 Phosphorylation S939 -0.637 _LLS(ph)PRPSLLTPTGDPR_
NCOR2 Phosphorylation S943 -0.740 _LLSPRPS(ph)LLTPTGDPR_
NCOR2 Phosphorylation S956 -0.223 -0.308 _ANAS(ph)PQKPLDLK_
NCOR2 Phosphorylation S1023 -0.334 _S(ph)RSPAPPADKEAFAAEAQK_
NCOR2 Phosphorylation S1025 1.950 _SRS(ph)PAPPADKEAFAAEAQK_
NCOR2 Phosphorylation T1383 -1.746 -2.157 _EGT(ph)PPPPPPSR_
NCOR2 Phosphorylation S1479 0.325 -0.132 _SLIGS(ph)PGR_
NCOR2 Phosphorylation S1778 -0.687 _HSSSPLS(ph)PGGPTHLTKPTTTSSSER_
NCOR2 Phosphorylation S1970 -0.321 _SGLEPAS(ph)SPSK_
NCOR2 Phosphorylation S1971 -0.480 _SGLEPASS(ph)PSK_
NCOR2 Phosphorylation S2223 -0.074 -1.140 _TSVLGGGEDGIEPVS(ph)PPEGMTEPGHSR_
NCOR2 Phosphorylation S2258 -0.573 -0.210 _S(ph)PGNTSQPPAFFSK_
NCOR2 Phosphorylation S2413 0.973 _AKS(ph)PAPGLASGDRPPSVSSVHSEGDCNR_
SAP30 Ubiquitylation K214 -0.201 -0.160 _SDLK(gl)VDSGVH_
SIN3A Ubiquitylation K155 0.182 _EFK(gl)SQSIDTPGVISR_
SIN3A Phosphorylation T266 -0.572 _VSKPSQLQAHTPASQQT(ph)PPLPPYASPR_
SIN3A Phosphorylation S277 -1.598 _S(ph)PPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNK_
SIN3A Phosphorylation S295 -1.959 _SPPVQPHTPVTISLGTAPS(ph)LQNNQPVEFNHAINYVNK_
SIN3A Ubiquitylation K638 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K639 -0.223 _VLEAIQK(gl)K_
SIN3A Ubiquitylation K715 1.012 _GFNK(gl)VWR_
SIN3A Phosphorylation S832 0.764 0.363 _GDLS(ph)DVEEEEEEEM(ox)DVDEATGAVKK_
SIN3A Ubiquitylation K875 0.131 0.003 _LLFSNTAAQK(gl)LR_
SIN3A Ubiquitylation K937 -0.224 -0.025 _DK(gl)SDSPAIQLR_
SIN3A Phosphorylation S940 -0.107 _DKSDS(ph)PAIQLR_
SIN3A Phosphorylation T1111 0.691 0.517 _YM(ox)NSDTT(ph)SPELR_
SIN3A Phosphorylation S1112 0.623 0.725 _YM(ox)NSDTTS(ph)PELR_


© Copyright Svejstrup Laboratory 2015